General Information

  • ID:  hor002300
  • Uniprot ID:  Q5XXR2(131-143)
  • Protein name:  Neuropeptide-glutamic acid-isoleucine
  • Gene name:  PMCH
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Melanin-concentrating hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0045202 synapse

Sequence Information

  • Sequence:  EIGDEENSAKFPI
  • Length:  13(131-143)
  • Propeptide:  MAKMSLSSYLLILTFSLFSQGILLSASKSIRNLEDDMVFNTFRLGKALQKEDTPQKSVVAPSLEQYKNDDSSFMNDEENKNSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
  • Signal peptide:  MAKMSLSSYLLILTFSLFSQG
  • Modification:  T13 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5XXR2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002300_AF2.pdbhor002300_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 166277 Formula: C63H97N15O24
Absent amino acids: CHLMQRTVWY Common amino acids: E
pI: 3.78 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -81.54 Boman Index: -2917
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 67.69
Instability Index: 6324.62 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA